Methionyl Aminopeptidase 1 (METAP1) Rabbit Polyclonal Antibody

SKU TA333843

Rabbit Polyclonal Anti-METAP1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-METAP1 Antibody: synthetic peptide directed towards the N terminal of human METAP1. Synthetic peptide located within the following region: GDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 30 kDa
• Gene Name: methionyl aminopeptidase 1
• Database Link:
  NP_055958
  P53582
• Background: METAP1 removes the amino-terminal methionine from nascent proteins. METAP1 is required for normal progression through the cell cycle.
• Synonyms: MAP1A; MetAP1A
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 82%

Reference Data

• Protein Families: Druggable Genome