SMG5 Rabbit Polyclonal Antibody

SKU TA333828

Rabbit Polyclonal Anti-SMG5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SMG5 Antibody: synthetic peptide directed towards the N terminal of human SMG5. Synthetic peptide located within the following region: MSQGPPTGESSEPEAKVLHTKRLYRAVVEAVHRLDLILCNKTAYQEVFKP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 114 kDa
• Gene Name: SMG5, nonsense mediated mRNA decay factor
• Database Link:
  NP_056142
  Q9UPR3
• Background: SMG5 plays a role in nonsense-mediated mRNA decay. SMG5 does not have RNase activity by itself. SMG5 promotes dephosphorylation of RENT1. SMG5 is necessary for TERT activity.SMG5 is involved in nonsense-mediated mRNA decay (Ohnishi et al., 2003 [PubMed 14636577]). [supplied by OMIM]
• Synonyms: EST1B; LPTS-RP1; LPTSRP1; SMG-5
• Note: Immunogen sequence homology: Human: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Rat: 86%; Guinea pig: 86%

Reference Data