CCDC28A Rabbit Polyclonal Antibody

SKU TA333821

Rabbit Polyclonal Anti-CCDC28A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CCDC28A Antibody: synthetic peptide directed towards the middle region of human CCDC28A. Synthetic peptide located within the following region: ERGLLSLLNDFHSGKLQAFGNECSIEQMEHVRGMQEKLARLNLELYGELE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 30 kDa
• Gene Name: coiled-coil domain containing 28A
• Database Link:
  NP_056254
  Q8IWP9
• Background: This gene is located in a region close to the locus of the pseudogene of chemokine (C-C motif) receptor-like 1 on chromosome 6. The specific function of this gene has not yet been determined.
• Synonyms: C6orf80; CCRL1AP
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome