RPAP1 Rabbit Polyclonal Antibody

SKU TA333811

Rabbit Polyclonal Anti-RPAP1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RPAP1 Antibody is: synthetic peptide directed towards the N-terminal region of Human RPAP1. Synthetic peptide located within the following region: RNQGCQLPGSSHSFQGPNLVTGKGLRDQEAEQEAQTIHEENIARLQAMAP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 144 kDa
• Gene Name: RNA polymerase II associated protein 1
• Database Link:
  NP_056355
  Q9BWH6
• Background: This protein forms part of the RNA polymerase II (RNAPII) enzyme complex and may recruit RNAPII to chromatin through its interaction with acetylated histones.
• Synonyms: DKFZp727M111; FLJ12732; KIAA1403; MGC858
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Dog: 86%; Bovine: 86%; Guinea pig: 79%

Reference Data