WDR21A (DCAF4) Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-DCAF4 Antibody: synthetic peptide directed towards the middle region of human DCAF4. Synthetic peptide located within the following region: ARLLRTIPSPYPASKADIPSVAFSSRLGGSRGAPGLLMAVGQDLYCYSYS |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 56 kDa |
Gene Name | DDB1 and CUL4 associated factor 4 |
Database Link | |
Background | DCAF4 is a WD repeat-containing protein. The function of DCAF4 remains unknown.This gene encodes a WD repeat-containing protein. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined. |
Synonyms | WDR21; WDR21A |
Note | Immunogen sequence homology: Human: 100%; Dog: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Pig: 86%; Rat: 86%; Horse: 86% |
Reference Data |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.