C1orf41 (HSPB11) Rabbit Polyclonal Antibody

SKU TA333782

Rabbit Polyclonal Anti-HSPB11 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HSPB11 Antibody is: synthetic peptide directed towards the middle region of Human HSPB11. Synthetic peptide located within the following region: IERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 13 kDa
• Gene Name: heat shock protein family B (small) member 11
• Database Link:
  NP_057210
  Q9Y547
• Background: The function of this protein remains unknown.
• Synonyms: C1orf41; HSPCO34; IFT25; PP25
• Note: Immunogen sequence homology: Dog: 100%; Human: 100%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Pig: 86%; Rat: 85%; Mouse: 79%

Reference Data