gamma Tubulin (TUBG2) Rabbit Polyclonal Antibody

SKU TA333777

Rabbit Polyclonal Anti-TUBG2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TUBG2 Antibody: synthetic peptide directed towards the middle region of human TUBG2. Synthetic peptide located within the following region: FDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 51 kDa
• Gene Name: tubulin gamma 2
• Database Link:
  NP_057521
  Q9NRH3
• Background: Tubulin is the major constituent of microtubules. Gamma tubulin is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome, suggesting that it is involved in the minus-end nucleation of microtubule assembly.
• Synonyms: MGC131994
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 85%; Yeast: 83%; Zebrafish: 83%

Reference Data

• Protein Families: Druggable Genome