SDAD1 Rabbit Polyclonal Antibody

SKU TA333758

Rabbit Polyclonal Anti-SDAD1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SDAD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human SDAD1. Synthetic peptide located within the following region: KTKTNPFSSSTNKEKKKQKNFMMMRYSQNVRSKNKRSFREKQLALRDALL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 64 kDa
• Gene Name: SDA1 domain containing 1
• Database Link:
  NP_060585
  Q9NVU7
• Background: SDAD1 is required for 60S pre-ribosomal subunits export to the cytoplasm.
• Synonyms: DKFZp686E22207; FLJ10498
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 86%; Mouse: 79%

Reference Data