SLC35C1 Rabbit Polyclonal Antibody

SKU TA333752

Rabbit Polyclonal Anti-SLC35C1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC35C1 Antibody: synthetic peptide directed towards the N terminal of human SLC35C1. Synthetic peptide located within the following region: TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 40 kDa
• Gene Name: solute carrier family 35 member C1
• Database Link:
  NP_060859
  Q96A29
• Background: SLC35C1 is involved in GDP-fucose import from the cytoplasm into the Golgi lumen.
• Synonyms: CDG2C; FUCT1
• Note: Immunogen sequence homology: Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 92%

Reference Data

• Protein Families: Transmembrane