SLC22A17 Rabbit Polyclonal Antibody

SKU TA333740

Rabbit Polyclonal Anti-SLC22A17 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC22A17 Antibody: synthetic peptide directed towards the middle region of human SLC22A17. Synthetic peptide located within the following region: HCYQPVGGGGSPSDFYLCSLLASGTAALACVFLGVTVDRFGRRGILLLSM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 58 kDa
• Gene Name: solute carrier family 22 member 17
• Database Link:
  NP_065105
  Q8WUG5
• Background: The specific functin of this protein remains unknown.
• Synonyms: 24p3R; BOCT; BOIT; hBOIT; NGALR; NGALR2; NGALR3
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane