SLCO1A2 Rabbit Polyclonal Antibody

SKU TA333729

Rabbit Polyclonal Anti-SLCO1A2 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLCO1A2 Antibody: synthetic peptide directed towards the middle region of human SLCO1A2. Synthetic peptide located within the following region: VCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 64 kDa
• Gene Name: solute carrier organic anion transporter family member 1A2
• Database Link:
  NP_066580
  P46721
• Background: SLCO1A2 is a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute carriers.
• Synonyms: OATP; OATP-A; OATP1A2; SLC21A3
• Note: Immunogen sequence homology: Dog: 100%; Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 79%

Reference Data

• Protein Families: Transmembrane