SLC26A1 Rabbit Polyclonal Antibody

SKU TA333710

Rabbit Polyclonal Anti-SLC26A1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC26A1 Antibody: synthetic peptide directed towards the C terminal of human SLC26A1. Synthetic peptide located within the following region: LYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRAALVPAAA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 77 kDa
• Gene Name: solute carrier family 26 member 1
• Database Link:
  NP_071325
  Q9H2B4
• Background: SLC26A1 is a member of sulfate/anion transporter family. Family members are well conserved in their protein (aa length among species) structures, but have markedly different tissue expression patterns. Its gene is primarily expressed in the liver, pancreas, and brain.This gene is a member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures, but have markedly different tissue expression patterns. This gene is primarily expressed in the liver, pancreas, and brain. Three splice variants that encode different isoforms have been identified.
• Synonyms: CAON; EDM4; SAT-1; SAT1
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Transmembrane