BIGM103 (SLC39A8) Rabbit Polyclonal Antibody

SKU TA333707

Rabbit Polyclonal Anti-SLC39A8 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human, Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC39A8 Antibody: synthetic peptide directed towards the N terminal of human SLC39A8. Synthetic peptide located within the following region: QLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLASLLGLILTPLIKKS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 50 kDa
• Gene Name: solute carrier family 39 member 8
• Database Link:
  NP_071437
  Q9C0K1
• Background: This gene encodes a member of the SLC39 family of solute-carrier genes, which show structural characteristics of zinc transporters. The encoded protein is glycosylated and found in the plasma membrane and mitochondria, and functions in the cellular import
• Synonyms: BIGM103; CDG2N; LZT-Hs6; PP3105; ZIP8
• Note: Immunogen sequence homology: Human: 100%; Pig: 85%; Dog: 79%; Horse: 79%

Reference Data

• Protein Families: Transmembrane