DEM1 (EXO5) Rabbit Polyclonal Antibody

SKU TA333699

Rabbit Polyclonal Anti-EXO5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DEM1 Antibody is: synthetic peptide directed towards the C-terminal region of Human DEM1. Synthetic peptide located within the following region: RPMLPLEAQKKKDCFQVSLYKYIFDAMVQGKVTPASLIHHTKLCLEKPLG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 41 kDa
• Gene Name: exonuclease 5
• Database Link:
  NP_073611
  Q9H790
• Background: DEM1 is a probable single strand DNA specific 5' exonuclease mitochondrial DNA replication and recombination.
• Synonyms: C1orf176; DEM1; Exo V; hExo5
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Horse: 86%; Mouse: 86%; Bovine: 83%

Reference Data