FATP3 (SLC27A3) Rabbit Polyclonal Antibody

SKU TA333683

Rabbit Polyclonal Anti-SLC27A3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC27A3 Antibody: synthetic peptide directed towards the middle region of human SLC27A3. Synthetic peptide located within the following region: PFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 79 kDa
• Gene Name: solute carrier family 27 member 3
• Database Link:
  NP_077306
  Q5K4L6
• Background: SLC27A3 has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids.SLC27A3 does not exhibit fatty acid transport activity.
• Synonyms: ACSVL3; FATP3; VLCS-3
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%

Reference Data

• Protein Families: Transmembrane