HAUS3 Rabbit Polyclonal Antibody

SKU TA333679

Rabbit Polyclonal Anti-HAUS3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HAUS3 Antibody is: synthetic peptide directed towards the middle region of Human HAUS3. Synthetic peptide located within the following region: KWAEESLHSLTSKAVDKENLDAKISSLTSEIMKLEKEVTQIKDRSLPAVV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 66 kDa
• Gene Name: HAUS augmin like complex subunit 3
• Database Link:
  NP_078787
  Q68CZ6
• Background: HAUS3 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb 'augmentare,' meaning 'to increase.' The augmin complex is a microtubule-binding complex involved in microtubule generation within the mitotic spindle and is vital to mitotic spindle assembly.
• Synonyms: C4orf15; dgt3; IT1
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Guinea pig: 93%; Rat: 86%; Bovine: 79%

Reference Data