ZNF408 Rabbit Polyclonal Antibody

SKU TA333666

Rabbit Polyclonal Anti-ZNF408 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF408 Antibody: synthetic peptide directed towards the middle region of human ZNF408. Synthetic peptide located within the following region: ERPFPCPQCGRAYTLATKLRRHLKSHLEDKPYRCPTCGMGYTLPQSLRRH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 78 kDa
• Gene Name: zinc finger protein 408
• Database Link:
  NP_079017
  Q9H9D4
• Background: The exact function of this protein remains unknown.
• Synonyms: FLJ12827
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%; Zebrafish: 93%

Reference Data

• Protein Families: Transcription Factors