MNF1 (UQCC2) Rabbit Polyclonal Antibody

SKU TA333617

Rabbit Polyclonal Anti-MNF1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MNF1 Antibody is: synthetic peptide directed towards the C-terminal region of Human MNF1. Synthetic peptide located within the following region: DTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEEDHKA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 13 kDa
• Gene Name: ubiquinol-cytochrome c reductase complex assembly factor 2
• Database Link:
  NP_115716
  Q9BRT2
• Background: This gene encodes a nucleoid protein localized to the mitochondria inner membrane. The encoded protein affects regulation of insulin secretion, mitochondrial ATP production, and myogenesis through modulation of mitochondrial respiratory chain activity.
• Synonyms: bA6B20.2; C6orf125; Cbp6; M19; MNF1
• Note: Immunogen sequence homology: Human: 100%; Rat: 79%; Mouse: 79%

Reference Data