PLA2G12B Rabbit Polyclonal Antibody

SKU TA333609

Rabbit Polyclonal Anti-PLA2G12B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PLA2G12B Antibody is: synthetic peptide directed towards the N-terminal region of Human PLA2G12B. Synthetic peptide located within the following region: LVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 19 kDa
• Gene Name: phospholipase A2 group XIIB
• Database Link:
  NP_115951
  Q9BX93
• Background: Phospholipase A2 (PLA2) enzymes catalyze hydrolysis of glycolipids to release free fatty acids and lysophospholipids. PLA2G12B belongs to the PLA2 family, but it is catalytically inactive due to an amino acid change in its active site and has altered phospholipid-binding properties.
• Synonyms: FKSG71; GXIIB; GXIIIsPLA2; PLA2G13; sPLA2-GXIIB
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Pig: 79%; Rat: 79%; Mouse: 79%

Reference Data

• Protein Families: Secreted Protein
• Protein Pathways: alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fc epsilon RI signaling pathway, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Vascular smooth muscle contraction, VEGF signaling pathway