SLC22A16 Rabbit Polyclonal Antibody

SKU TA333589

Rabbit Polyclonal Anti-SLC22A16 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC22A16 Antibody: synthetic peptide directed towards the N terminal of human SLC22A16. Synthetic peptide located within the following region: CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 63 kDa
• Gene Name: solute carrier family 22 member 16
• Database Link:
  NP_149116
  Q86VW1
• Background: Organic ion transporters, such as SLC22A16, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).Organic ion transporters, such as SLC22A16, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs). [supplied by OMIM]
• Synonyms: CT2; dJ261K5.1; FLIPT2; OAT6; OCT6; OKB1
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Transmembrane