FAM78A Rabbit Polyclonal Antibody

SKU TA333582

Rabbit Polyclonal Anti-FAM78A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FAM78A Antibody: synthetic peptide directed towards the N terminal of human FAM78A. Synthetic peptide located within the following region: MPGFFCDCWPSLEIRALLYAMGCIQSIGGKARVFREGITVIDVKASIDPV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: family with sequence similarity 78 member A
• Database Link:
  NP_203745
  Q5JUQ0
• Background: The exact functions of FAM78A remain unknown.
• Synonyms: C9orf59
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Guinea pig: 86%

Reference Data