CCDC120 Rabbit Polyclonal Antibody

SKU TA333577

Rabbit Polyclonal Anti-CCDC120 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CCDC120 Antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC120. Synthetic peptide located within the following region: SGSQDSQMGFPRADPASDRASLFVARTRRSNSSEALLVDRAAGGGAGSPP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 67 kDa
• Gene Name: coiled-coil domain containing 120
• Database Link:
  NP_296375
  Q96HB5
• Background: This gene encodes a protein that contains a coiled-coil domain. Four alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.
• Synonyms: JM11
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 91%

Reference Data