G0 Protein alpha (GNAO1) Rabbit Polyclonal Antibody

SKU TA333538

Rabbit Polyclonal Anti-GNAO1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GNAO1 Antibody: synthetic peptide directed towards the middle region of human GNAO1. Synthetic peptide located within the following region: CDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 40 kDa
• Gene Name: G protein subunit alpha o1
• Database Link:
  NP_620073
  P09471
• Background: Activated Goalpha interacted directly with PLZF, and enhanced its function as a transcriptional and cell growth suppressor. Goalpha might play a role in mediating extracellular signal-regulated kinase activation by G protein-coupled receptors in the brain.
• Synonyms: EIEE17; G-ALPHA-o; GNAO; HLA-DQB1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Long-term depression, Melanogenesis