WDR85 (DPH7) Rabbit Polyclonal Antibody

SKU TA333533

Rabbit Polyclonal Anti-DPH7 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-WDR85 Antibody is: synthetic peptide directed towards the N-terminal region of Human WDR85. Synthetic peptide located within the following region: CPLQGCRHLLACGTYQLRRPEDRPAGPQNKGGMEVKEPQVRLGRLFLYSF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 50 kDa
• Gene Name: diphthamide biosynthesis 7
• Database Link:
  NP_620133
  Q9BTV6
• Background: WDR85 is a WD repeat-containing protein that plays a role in the first step of diphthamide biosynthesis.
• Synonyms: C9orf112; RRT2; WDR85
• Note: Immunogen sequence homology: Human: 100%

Reference Data