C6orf72 (GINM1) Rabbit Polyclonal Antibody

SKU TA333532

Rabbit Polyclonal Anti-GINM1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GINM1 Antibody is: synthetic peptide directed towards the middle region of Human GINM1. Synthetic peptide located within the following region: SVRILVHEWPMTSGSSLQLIVIQEEVVEIDGKQVQQKDVTEIDILVKNRG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 34 kDa
• Gene Name: glycoprotein integral membrane 1
• Database Link:
  NP_620140
  Q9NU53
• Background: The function of this protein remains unknown.
• Synonyms: C6orf72; dJ12G14.2
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Pig: 86%; Guinea pig: 86%; Mouse: 79%; Rabbit: 79%

Reference Data

• Protein Families: Transmembrane