OriGene Logo

C6orf72 (GINM1) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA333532
Rabbit Polyclonal Anti-GINM1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
In Control Promo
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY408522 Transient overexpression lysate of chromosome 6 open reading frame 72 (C6orf72)
100 ug
$436.00
TP304800 Recombinant protein of human chromosome 6 open reading frame 72 (C6orf72), 20 µg 20 ug
$737.00

View other "C6orf72 or NM_138785" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-GINM1 Antibody is: synthetic peptide directed towards the middle region of Human GINM1. Synthetic peptide located within the following region: SVRILVHEWPMTSGSSLQLIVIQEEVVEIDGKQVQQKDVTEIDILVKNRG
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 34 kDa
Gene Name glycoprotein integral membrane 1
Database Link
Background The function of this protein remains unknown.
Synonyms C6orf72; dJ12G14.2
Note Immunogen sequence homology: Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Pig: 86%; Guinea pig: 86%; Mouse: 79%; Rabbit: 79%
Reference Data
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.