SLC39A11 Rabbit Polyclonal Antibody

SKU TA333529

Rabbit Polyclonal Anti-SLC39A11 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC39A11 Antibody: synthetic peptide directed towards the middle region of human SLC39A11. Synthetic peptide located within the following region: GGSSWRRIALLILAITIHNVPEGLAVGVGFGAIEKTASATFESARNLAIG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: solute carrier family 39 member 11
• Database Link:
  NP_631916
  Q8N1S5
• Background: SLC39A11 belongs to the ZIP transporter (TC 2.A.5) family. It is a multi-pass membrane protein. SLC39A11 may act as a zinc-influx transporter.
• Synonyms: C17orf26; ZIP11
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%

Reference Data

• Protein Families: Transmembrane