ZNF23 Rabbit Polyclonal Antibody

SKU TA333496

Rabbit Polyclonal Anti-ZNF23 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF23 Antibody: synthetic peptide directed towards the N terminal of human ZNF23. Synthetic peptide located within the following region: MLENYGNVASLGFPLLKPAVISQLEGGSELGGSSPLAAGTGLQGLQTDIQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 73 kDa
• Gene Name: zinc finger protein 23
• Database Link:
  NP_666016
  P17027
• Background: ZNF23 (GZF1) has a BTB/POZ (broad complex, tramtrack, and bric-a-brac)/(poxvirus and zinc finger) domain and 10 tandemly repeated zinc finger motifs with strong transcriptional repressive activity.
• Synonyms: KOX16; Zfp612; ZNF359; ZNF612
• Note: Immunogen sequence homology: Human: 100%; Dog: 86%; Rat: 86%; Mouse: 86%; Pig: 79%; Horse: 79%; Bovine: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transcription Factors