Tpgs1 Rabbit Polyclonal Antibody

SKU
TA333491
Rabbit Polyclonal Anti-Tpgs1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Tpgs1 Antibody is: synthetic peptide directed towards the middle region of Mouse Tpgs1. Synthetic peptide located within the following region: DGRTYSELLKRVCRDGGAPEEVVAPLLRKIQCRDHEAVPLGIFRTGMLSC
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 32 kDa
Gene Name tubulin polyglutamylase complex subunit 1
Database Link
Background Tpgs1 may act in the targeting of the tubulin polyglutamylase complex. It is required for the development of the spermatid flagellum.
Synonyms AV005629; Gm16517; Gtrgeo22; PGs1
Note Immunogen sequence homology: Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Mouse: 92%; Bovine: 92%; Guinea pig: 92%; Rabbit: 77%
Reference Data
Write Your Own Review
You're reviewing:Tpgs1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.