SLC43A2 Rabbit Polyclonal Antibody

SKU TA333487

Rabbit Polyclonal Anti-SLC43A2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC43A2 Antibody: synthetic peptide directed towards the N terminal of human SLC43A2. Synthetic peptide located within the following region: TEPENVTNGTVGGTAEPGHEEVSWMNGWLSCQAQDEMLNLAFTVGSFLLS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 53 kDa
• Gene Name: solute carrier family 43 member 2
• Database Link:
  NP_689559
  Q8N370
• Background: SLC43A2 is a Sodium-, chloride, pH-independent high affinity transport of large neutral amino acids.
• Synonyms: LAT4
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 86%; Rat: 86%; Horse: 85%; Bovine: 79%

Reference Data

• Protein Families: Transmembrane