SLC39A12 Rabbit Polyclonal Antibody

SKU TA333474

Rabbit Polyclonal Anti-SLC39A12 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC39A12 Antibody: synthetic peptide directed towards the N terminal of human SLC39A12. Synthetic peptide located within the following region: MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 73 kDa
• Gene Name: solute carrier family 39 member 12
• Database Link:
  NP_689938
  Q504Y0
• Background: SLC39A12 may act as a zinc-influx transporter and also may be partly involved in the outbreak of schizophrenia.
• Synonyms: bA570F3.1; LZT-Hs8; ZIP-12
• Note: Immunogen sequence homology: Human: 100%; Horse: 85%; Bovine: 77%

Reference Data

• Protein Families: Transmembrane