C12orf59 (TMEM52B) Rabbit Polyclonal Antibody

SKU TA333472

Rabbit Polyclonal Anti-TMEM52B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TMEM52B Antibody is: synthetic peptide directed towards the C-terminal region of Human TMEM52B. Synthetic peptide located within the following region: LGQLPSSLDTLPGYEEALHMSRFTVAMCGQKAPDLPPVPEEKQLPPTEKE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 20 kDa
• Gene Name: transmembrane protein 52B
• Database Link:
  NP_694567
  Q4KMG9
• Background: The function of this protein remains unknown.
• Synonyms: C12orf59
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Rat: 93%; Bovine: 93%; Rabbit: 92%; Mouse: 86%

Reference Data

• Protein Families: Transmembrane