EFHA2 (MICU3) Rabbit Polyclonal Antibody

SKU
TA333407
Rabbit Polyclonal Anti-EFHA2 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-EFHA2 Antibody: synthetic peptide directed towards the N terminal of human EFHA2. Synthetic peptide located within the following region: TLGLPGRPFSSREDEERAVAEAAWRRRRRWGELSVAAAAGGGLVGLVCYQ
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 61 kDa
Gene Name mitochondrial calcium uptake family member 3
Database Link
Background The specific function of this protein remains unknown.
Synonyms EFHA2
Note Immunogen sequence homology: Human: 100%; Yeast: 100%; Rabbit: 93%; Pig: 83%; Horse: 83%; Dog: 75%; Bovine: 75%
Reference Data
Write Your Own Review
You're reviewing:EFHA2 (MICU3) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.