ZNF50 (ZSCAN22) Rabbit Polyclonal Antibody

SKU TA333403

Rabbit Polyclonal Anti-ZSCAN22 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZSCAN22 Antibody is: synthetic peptide directed towards the N-terminal region of Human ZSCAN22. Synthetic peptide located within the following region: RFRHFRYEEASGPHEALAHLRALCCQWLQPEAHSKEQILELLVLEQFLGA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 54 kDa
• Gene Name: zinc finger and SCAN domain containing 22
• Database Link:
  NP_862829
  P10073
• Background: ZSCAN22 may be involved in transcriptional regulation.
• Synonyms: HKR2; ZNF50
• Note: Immunogen sequence homology: Human: 100%; Rat: 93%; Rabbit: 92%; Mouse: 86%; Dog: 85%; Pig: 85%; Horse: 85%; Bovine: 85%; Guinea pig: 85%

Reference Data

• Protein Families: Druggable Genome