CCDC172 Rabbit Polyclonal Antibody

CAT#: TA333360

Rabbit Polyclonal Anti-C10orf96 Antibody

Product Images

WB Suggested Anti-C10orf96 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-C10orf96 Antibody: synthetic peptide directed towards the middle region of human C10orf96. Synthetic peptide located within the following region: QANMLKSEMKSMEHDSSQLNELQKQKSELIQELFTLQRKLKVFEDEENES
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: coiled-coil domain containing 172
• Database Link:
  NP_940917
  Entrez Gene 374355 Human
  UniProt ID P0C7W6
• Background: The specific function of this protein remains unknown.
• Synonyms: C10orf96
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Dog: 86%; Rabbit: 86%; Guinea pig: 86%; Horse: 85%; Yeast: 85%; Bovine: 79%