CCDC172 Rabbit Polyclonal Antibody

SKU
TA333360
Rabbit Polyclonal Anti-C10orf96 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-C10orf96 Antibody: synthetic peptide directed towards the middle region of human C10orf96. Synthetic peptide located within the following region: QANMLKSEMKSMEHDSSQLNELQKQKSELIQELFTLQRKLKVFEDEENES
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 31 kDa
Gene Name coiled-coil domain containing 172
Database Link
Background The specific function of this protein remains unknown.
Synonyms C10orf96
Note Immunogen sequence homology: Human: 100%; Pig: 93%; Dog: 86%; Rabbit: 86%; Guinea pig: 86%; Horse: 85%; Yeast: 85%; Bovine: 79%
Reference Data
Write Your Own Review
You're reviewing:CCDC172 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.