AMIGO3 Rabbit Polyclonal Antibody

SKU TA333345

Rabbit Polyclonal Anti-AMIGO3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-AMIGO3 Antibody: synthetic peptide directed towards the N terminal of human AMIGO3. Synthetic peptide located within the following region: MTWLVLLGTLLCMLRVGLGTPDSEGFPPRALHNCPYKCICAADLLSCTGL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 55 kDa
• Gene Name: adhesion molecule with Ig-like domain 3
• Database Link:
  NP_942015
  Q86WK7
• Background: AMIGO3 may mediate heterophilic cell-cell interaction. AMIGO3 may contribute to signal transduction through its intracellular domain.
• Synonyms: ALI3; AMIGO-3
• Note: Immunogen sequence homology: Human: 100%; Pig: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transmembrane