RIPK5 (DSTYK) Rabbit Polyclonal Antibody

SKU TA333333

Rabbit Polyclonal Anti-DSTYK Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DSTYK Antibody: synthetic peptide directed towards the middle region of human RIPK5. Synthetic peptide located within the following region: EECWQLMEACWDGDPLKRPLLGIVQPMLQGIMNRLCKSNSEQPNRGLDDS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 100 kDa
• Gene Name: dual serine/threonine and tyrosine protein kinase
• Database Link:
  NP_955749
  Q6XUX3
• Background: RIPK5 may induce both caspase-dependent apoptosis and caspase-independent cell death.This gene encodes a dual serine/threonine and tyrosine protein kinase which is expressed in multiple tissues. Multiple alternatively spliced transcript variants have been found, but the biological validity of some variants has not been determined.
• Synonyms: CAKUT1; DustyPK; HDCMD38P; RIP5; RIPK5
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Rat: 90%; Mouse: 86%; Bovine: 86%; Rabbit: 85%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase