WIPI2 Rabbit Polyclonal Antibody

SKU TA332246

Rabbit Polyclonal Anti-WIPI2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-WIPI2 Antibody is: synthetic peptide directed towards the C-terminal region of Human WIPI2. Synthetic peptide located within the following region: AFSMDGMFLSASSNTETVHIFKLETVKEKPPEEPTTWTGYFGKVLMASTS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: WD repeat domain, phosphoinositide interacting 2
• Database Link:
  NP_001028692
  Q9Y4P8
• Background: WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI subfamily of WD40 repeat proteins, such as WIPI2, have a 7-bladed propeller structure and contain a conserved motif for interaction with phospholipids.
• Synonyms: ATG18B; Atg21; CGI-50; WIPI-2
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%; Horse: 86%; Mouse: 86%; Zebrafish: 79%

Reference Data