EFTUD1 (EFL1) Rabbit Polyclonal Antibody

SKU TA332232

Rabbit Polyclonal Anti-EFTUD1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-EFTUD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human EFTUD1. Synthetic peptide located within the following region: TTEEEYLHFGEKADSENQARKYMNAVRKRKGLYVEEKIVEHAEKQRTLSK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 117 kDa
• Gene Name: elongation factor like GTPase 1
• Database Link:
  NP_001035700
  Q7Z2Z2
• Background: EFTUD1 is involved in the biogenesis of the 60S ribosomal subunit and translational activation of ribosomes. Together with SBDS, EFTUD1 triggers the GTP-dependent release of EIF6 from 60S pre-ribosomes in the cytoplasm, thereby activating ribosomes for translation competence by allowing 80S ribosome assembly and facilitating EIF6 recycling to the nucleus, where it is required for 60S rRNA processing and nuclear export. EFTUD1 has low intrinsic GTPase activity. GTPase activity is increased by contact with 60S ribosome subunits.
• Synonyms: EFTUD1; FAM42A; HsT19294; RIA1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data