C3orf26 Rabbit Antibody
| Product Data | |
| Reactivity | Human |
|---|---|
| Antibody Host | Rabbit |
| Isotype | IgG |
| Immunogen | The immunogen for Anti-C3orf26 Antibody is: synthetic peptide directed towards the N-terminal region of Human C3orf26. Synthetic peptide located within the following region: EASDGEGEGDTEVMQQETVPVPVPSEKTKQPKECFLIQPKERKENTTKTR |
| Buffer | Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Ambient |
| Predicted Protein Size | 28 kDa |
| Database Link | |
| Background | The function of this protein remains unknown. |
| Synonyms | C3orf26 |
| Note | Immunogen sequence homology: Human: 100%; Rat: 86%; Dog: 81%; Pig: 81%; Rabbit: 81%; Mouse: 79% |
| Reference Data | |
Write Your Own Review
| Product Manuals |
| FAQs |
| SDS |
Related Products
Check items to add to the cart or
![GAPDH Mouse Monoclonal Antibody [Clone ID: OTI2D9]](https://cdn.origene.com/catalog/product/assets/images/antibody/100/ta802519-3-w.jpg?width=140&height=140&store=america&image-type=small_image)
![beta Actin (ACTB) Mouse Monoclonal Antibody [Clone ID: OTI1]](https://cdn.origene.com/catalog/product/assets/images/antibody/100/ta811000-3-w.jpg?width=140&height=140&store=america&image-type=small_image)
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.