ZFAT Rabbit Polyclonal Antibody

CAT#: TA332158

Reviews ()
Write a review

Rabbit Polyclonal Anti-ZFAT1 Antibody


 Product Datasheet for 'TA332158'

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ZFAT1 Antibody: synthetic peptide directed towards the middle region of human ZFAT1. Synthetic peptide located within the following region: KHIRDAHDPQDKKVKEALDELCLMTREGKRQLLYDCHICERKFKNELDRD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Predicted Protein Size 94 kDa
Gene Name zinc finger and AT-hook domain containing
Background ZFAT1 may be involved in transcriptional regulation. Overexpression of ZFAT1causes down-regulation of a number of genes involved in the immune response. Some genes are also up-regulated.
Synonyms AITD3; ZFAT1; ZNF406
Note Immunogen sequence homology: Horse: 100%; Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%
Reference Data
Other products for "ZFAT"
Frequently bought together (2)
Transient overexpression lysate of zinc finger and AT hook domain containing (ZFAT), transcript variant 5
    • 100 ug

USD 495.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
BOGO Free lysates
68 Mouse Clones