ZFAT Rabbit Polyclonal Antibody

SKU TA332158

Rabbit Polyclonal Anti-ZFAT1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZFAT1 Antibody: synthetic peptide directed towards the middle region of human ZFAT1. Synthetic peptide located within the following region: KHIRDAHDPQDKKVKEALDELCLMTREGKRQLLYDCHICERKFKNELDRD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 94 kDa
• Gene Name: zinc finger and AT-hook domain containing
• Database Link:
  NP_001167629
  Q9P243
• Background: ZFAT1 may be involved in transcriptional regulation. Overexpression of ZFAT1causes down-regulation of a number of genes involved in the immune response. Some genes are also up-regulated.
• Synonyms: AITD3; ZFAT1; ZNF406
• Note: Immunogen sequence homology: Horse: 100%; Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%

Reference Data