SERINC4 Rabbit Polyclonal Antibody

SKU TA332144

Rabbit Polyclonal Anti-SERINC4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SERINC4 Antibody is: synthetic peptide directed towards the middle region of Human SERINC4. Synthetic peptide located within the following region: IVKVYSYEFQKPSLCFCCPETVEADKGQRGGAARPADQETPPAPPVQVQH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 30 kDa
• Gene Name: serine incorporator 4
• Database Link:
  NP_001244961
  A6NH21
• Background: SERINC4 incorporates a polar amino acid serine into membranes and facilitates the synthesis of two serine-derived lipids, phosphatidylserine and sphingolipids.
• Synonyms: FLJ40363
• Note: Immunogen sequence homology: Human: 100%; Horse: 77%; Rabbit: 77%

Reference Data

• Protein Families: Transmembrane