CCN3 (NOV) Rabbit Polyclonal Antibody

SKU TA332128

Rabbit Polyclonal Anti-NOV Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NOV Antibody: synthetic peptide directed towards the C terminal of human NOV. Synthetic peptide located within the following region: KTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: nephroblastoma overexpressed
• Database Link:
  NP_002505
  P48745
• Background: As an immediate-early protein, NOV is likely to play a role in cell growth regulation.
• Synonyms: CCN3; IBP-9; IGFBP-9; IGFBP9; NOVh
• Note: Immunogen sequence homology: Human: 100%; Rat: 92%; Mouse: 85%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Secreted Protein