PLRG1 Rabbit Polyclonal Antibody

SKU TA332120

Rabbit Polyclonal Anti-PLRG1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PLRG1 Antibody: synthetic peptide directed towards the N terminal of human PLRG1. Synthetic peptide located within the following region: YGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGTHPYP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 57 kDa
• Gene Name: pleiotropic regulator 1
• Database Link:
  NP_002660
  O43660
• Background: PLRG1 is necessary for spliceosome assembly and for pre-mRNA splicing.
• Synonyms: Cwc1; PRL1; PRP46; PRPF46; TANGO4
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 92%; Horse: 92%; Bovine: 85%; Dog: 83%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Spliceosome