UBE2N Rabbit Polyclonal Antibody

SKU TA332104

Rabbit Polyclonal Anti-UBE2N Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-UBE2N Antibody: synthetic peptide directed towards the middle region of human UBE2N. Synthetic peptide located within the following region: GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 17 kDa
• Gene Name: ubiquitin conjugating enzyme E2 N
• Database Link:
  NP_003339
  P61088
• Background: UBE2N encodes a member of the E2 ubiquitin-conjugating enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. Studies in mouse suggest that this protein plays a role in DNA postreplication repair.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Studies in mouse suggest that this protein plays a role in DNA postreplication repair.
• Synonyms: HEL-S-71; UBC13; UbcH-ben; UbcH13; UBCHBEN
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Ubiquitin mediated proteolysis