AP4M1 Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-AP4M1 Antibody is: synthetic peptide directed towards the C-terminal region of Human AP4M1. Synthetic peptide located within the following region: QELSSPEQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLS |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 50 kDa |
Gene Name | adaptor related protein complex 4 mu 1 subunit |
Database Link | |
Background | This gene encodes a subunit of the heterotetrameric AP-4 complex. The encoded protein belongs to the adaptor complexes medium subunits family. This AP-4 complex is involved in the recognition and sorting of cargo proteins with tyrosine-based motifs from the trans-golgi network to the endosomal-lysosomal system. |
Synonyms | CPSQ3; MU-4; MU-ARP2; SPG50 |
Note | Immunogen sequence homology: Human: 100%; Rat: 93%; Goat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Mouse: 86%; Guinea pig: 86% |
Reference Data | |
Protein Pathways | Lysosome |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.