Thioredoxin domain containing 9 (TXNDC9) Rabbit Polyclonal Antibody

SKU TA332051

Rabbit Polyclonal Anti-TXNDC9 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TXNDC9 Antibody is: synthetic peptide directed towards the N-terminal region of Human TXNDC9. Synthetic peptide located within the following region: VDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 25 kDa
• Gene Name: thioredoxin domain containing 9
• Database Link:
  NP_005774
  O14530
• Background: The protein encoded by this gene is a member of the thioredoxin family. The exact function of this protein is not known but it is associated with cell differentiation.
• Synonyms: APACD; PHLP3
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Zebrafish: 91%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome