SLC25A17 Rabbit Polyclonal Antibody

SKU TA332038

Rabbit Polyclonal Anti-SLC25A17 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC25A17 Antibody is: synthetic peptide directed towards the N-terminal region of Human SLC25A17. Synthetic peptide located within the following region: APYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKDLVVGFVAG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 34 kDa
• Gene Name: solute carrier family 25 member 17
• Database Link:
  NP_006349
  O43808
• Background: This gene encodes a peroxisomal membrane protein that belongs to the family of mitochondrial solute carriers. It is expressed in the liver, and is likely involved in transport.
• Synonyms: PMP34
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Sheep: 93%; Bovine: 93%; Rat: 92%; Dog: 86%; Horse: 86%; Rabbit: 86%; Mouse: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane