ENTR1 Rabbit Polyclonal Antibody

SKU
TA332028
Rabbit Polyclonal Anti-SDCCAG3 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-SDCCAG3 Antibody is: synthetic peptide directed towards the C-terminal region of Human SDCCAG3. Synthetic peptide located within the following region: PAGSPSADFAVHGESLGDRHLRTLQISYDALKDENSKLRRKLNEVQSFSE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 39 kDa
Gene Name serologically defined colon cancer antigen 3
Database Link
Background SDCCAG3 may be involved in modulation of TNF response and may be involved in presentation of TNFRSF1A on the cell surface.
Synonyms NY-CO-3
Note Immunogen sequence homology: Horse: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%
Reference Data
Write Your Own Review
You're reviewing:ENTR1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.